desain undangan, jenis kertas undangan, undangan simple, undangan hd, undangan elegan

Jenis Kertas Undangan Pernikahan dan Contoh Desain Undangan

Jenis Kertas Undangan – Pernikahan merupakan suatu hal yang begitu istimewa. Sehingga kebanyakan orang menginginkan apapun yang berhubungan dengan pernikahan mereka adalah yang teristimewa.

Tak terkecuali dengan undangan pernikahan. Mereka menginginkan undangan yang bagus karena itu hanya untuk sekali dalam seumur hidup. Kualitas undangan tidak hanya terlihat dari desain undangannya saja, tapi jenis kertasnya pun juga mempengaruhi.

Jenis Kertas Undangan

Terdapat banyak sekali jenis undangan saat ini yang dapat dijadikan pilihan. Itupun juga bisa disesuaikan dengan budget. Berikut jenis kertas undangan untuk printer maupun cetak offset.

1. Art Paper

desain undangan, jenis kertas undangan, kertas undangan art paper, desain undangan unik, desain undangan keren, desain undangan hd
keepo.me

Art paper mempunyai permukaan yang halus, licin, dan efek glossy. Biasanya kertas ini digunakan untuk hard cover undangan, namun ada juga yang menjadikannya sebagai isi undangan.

Hasil cetakan menggunakan kertas ini lebih bagus karena rasternya halus dan tidak menyerap air. Sehingga warna yang didapatkan akan lebih solid. Undangan akan terlihat lebih mewah jika ditamabah laminasi glossy, doff, atau UV.

Ukuran Kertas (85 gram)Harga
65 cm x 90 cmRp 370.451,-/Rim Plano
65 cm x 100 cmRp 411.613,-/Rim Plano
79 cm x 109 cmRp 545.292,-/Rim Plano

Variasi gramatur dari art paper adalah 85 gram, 100 gram, 115 gram, 120 gram, dan 150 gram.

2. Art Cartoon

undangan hard cover, desain undangan, jenis kertas undangan, kertas undangan art carton, art karton, desain undangan unik, desain undangan keren, desain undangan hd
ragamfashion.com

Jenis kertas art cartoon dan art paper sebenarnya hampir sama. Tapi yang membedakan hanya satu, yaitu ketebalannya. Pada undangan, biasanya kertas ini digunakan untuk hard cover. Art cartoon tidak hanya digunakan untuk undangan, tetapi juga digunakan sebagai:

  • Brosur
  • Katalog
  • Paper bag
  • Kartu nama
  • Cover buku
  • Company profle
  • Map, dll
Ukuran Kertas (230 gram)Harga
65 cm x 100 cmRp 1.046.500,-/Rim Plano
Ivory
79 cm x 109 cmRp 1.386.500,-/Rim Plano

Art cartoon memiliki variasi gramatur mulai dari 190 gram, 210 gram, 230 gram, 260 gram, 310 gram, 350 gram, dan 400 gram.

3. Kertas Jasmine

desain undangan, jenis kertas undangan, kertas undangan jasmine, kertas jasmine, desain undangan unik, desain undangan keren, desain undangan hd
ragamfashion.com

Kertas undangan jasmine ini memiliki tekstur gliter. Pada dunia percetakan jenis kertas inilah yang paling banyak digunakan. Kertas jasmine tidak bisa melalui proses percetakan. Melainkan hanya dapat menggunakan teknik emboss atau deboss

Alasan mengapa kertas undangan ini tidak melalui proses percetakan dikarenakan dia sulit menyerap tinta. Jika melalui proses percetakan dengan tinta maka proses pengeringannya akan lama.

4. Kertas Ivory

desain undangan, jenis kertas undangan, kertas undangan ivory, kertas ivory, desain undangan unik, desain undangan keren, desain undangan hd
taswirproduction.com

Kertas ivory adalah kertas undangan yang memadukan antara art cartoon, art paper, dan matt paper. Ivory ini memiliki dasar yang mengkilap pada satu sisi dan sisi yang lainnya bersifat doff.

Jenis kertas undangan ini sangat cocok dipadukan dengan desain udangan yang unik. Pilihan gramasi dari kertas ini adalah 210 gram, 250 gram, 300 gram, 350 gram dan 400 gram.

5. Matt Paper

desain undangan, jenis kertas undangan, kertas undangan matt paper, kertas matt paper, desain undangan unik, desain undangan keren, desain undangan hd
katumbiribogor.wordpress.com

Jika dilihat secara sekilas, matt paper sebenarnya memiliki persamaan dengan art paper. Tapi pada dasarnya, jika dilihat lebih jelas kedua kertas itu memiliki perbedaan. Jenis kertas ini lebih cepat menyerap tinta serta permukaannya tidak mengkilap.

Biasanya kertas ini juga digunakan untuk mencetak majalah, hal ini dikarenakan dapat memberi nuansa doff sehingga lebih terkesan elegan. Itulah yang membuat kertas ini sangat banyak digunakan. Daya resapnya terhadap tinta juga cukup tinggi.

Variasi gramatur dari matt paper yang dapat dipilih adalah 85 gram, 100 gram, 120 gram danĀ 150 gram.

6. Mecy Paper

desain undangan, jenis kertas undangan, kertas undangan mecy paper, kertas mecy paper, desain undangan unik, desain undangan keren, desain undangan hd
coconutcard.com

Mecy paper adalah kertas yang mempunyai tektur dan agak gliter-gliter, pilihan warnanya juga beragam. Jenis kertas undangan ini hanya mempunyai dua gramatur, yakni tebal dan tipis.

7. Fancy Paper

desain undangan, jenis kertas undangan, kertas undangan fancy paper, kertas fancy paper , desain undangan unik, desain undangan keren, desain undangan hd
fjb.kaskus.co.id

Jenis kertas undangan ini memiliki ragam warna dan karakteristik. Jenis kertas fancy paper antara lain seperti kertas java, kertas milano, kertas hawai, dan lain-lain. Fancy paper hanya memiliki dua gramatur, yakni tebal dan tipis.

8. Aster

desain undangan, jenis kertas undangan, kertas undangan aster, kertas aster , desain undangan unik, desain undangan keren, desain undangan hd
undangannikahmurahmeriah.wordpress.com

Kertas aster memiliki tekstur yang halus tetapi tidak coated. Warnanya juga tersedia banyak macam. Bagi yang menginginkan undangan pernikahan eksklusif, kertas aster ini adalah pilihan yang tepat. Dikarenakan kualitasnya yang bagus, jadi harganya juga mahal.

Selain untuk kertas undangan, kertas aster juga termasuk jenis kertas untuk mencetak sertifikat, kartu nama, piagam penghargaan, dan lain-lain. Pada umumnya, gramatur yang dipakai adalah 260 gram.

9. Recycle Look

desain undangan, jenis kertas undangan, kertas undangan Recycle Look, kertas Recycle Look, desain undangan unik, desain undangan keren, desain undangan hd
www.tokopedia.com

Sesuai dengan namanya, recycle look merupakan kertas yang berasal dari proses daur ulang dan memiliki warna coklat. Apabila digunakan untuk undangan maka akan memberikan kesan natural yang sangat kental.

Jenis kertas yang sering dipakai adalah kertas samson dan kertas kraft. Kedua kertas itu yang dapat masuk ke mesin cetak. Kertas ini juga digunakan untuk membuat bungkus dan paper bag. Gramatur yang sekarang dipakai adalah 70 gram.

10. Brief Cad

desain undangan, jenis kertas undangan, kertas undangan brief cad, kertas brief cad, desain undangan unik, desain undangan keren, desain undangan hd
shopee.co.id

Kebanyakan orang mengenal kertas brief cad ini dengan sebutan kertas manila. Jenis kertas ini memiliki banyak pilihan warna, antara lain yang populer adalah merah, kuning, hijau, biru, putih.

Dulu kertas ini digunakan sebagai kertas cetakan yang berada di sekolah atau kantor pemerintah dan swasta. Contoh penggunaan brief cad adalah:

  • Kartu absensi
  • Kartu pembayaran rumah sakit
  • Kartu pembayaran sekolah
  • Kartu stok perusahaan
  • Form isian data produksi di perusahaan swasta

Tapi saat ini, kertas brief cad juga digunakan untuk mencetak undangan. Akan tetapi undangan yang dicetak menggunakan jenis kertas ini dapat dibilang memiliki kualitas yang kurang baik dan harganya murah.

Tapi bukan berarti tidak perlu menggunakan kertas ini untuk mencetak undangan. Undangan akan menjadi bagus dengan adanya desain yang menarik.

11. Blues White

desain undangan, jenis kertas undangan, kertas undangan blues white, kertas blues white, desain undangan unik, desain undangan keren, desain undangan hd
pernikahan.co

Tekstur yang dimiliki kertas blues white hampir sama dengan kertas brief card. Ketebalannya juga sama, yaitu dengan gramasi yang pada umumnya digunakan adalah 220 gram hingga 250 gram.

Tetapi yang kebanyakan digunakan adalah kertas blues white import. Sudah jelas harganya lebih mahal. Namun akan sebanding dengan hasil cetakannya dengan warna tinta lebih solid dan tajam. Sedangkan hasil cetakan pada kertas BW lokal terlihat merampang (warna cetakan pudar).

12. Samson Kraft

desain undangan, jenis kertas undangan, kertas undangan samson kraft, kertas samson kraft, desain undangan unik, desain undangan keren, desain undangan hd
www.etsy.com

Samson kraft merupakan jenis kertas yang merupakan hasil daur ulang. Warnanya coklat kusam dengan tekstur kasar, bahkan ketika diusap terasa ada pasir-pasirnya. Ketika dijadikan kertas undangan memberikan kesan klasik.

Jika undangan didesain dengan simple dan se-apik mungkin, maka akan menghasilkan undangan yang luar biasa. Kesan klasik tersebut yang menarik perhatian banyak orang sehingga banyak yang menyukainya.

Undangan yang menggunakan kertas samson kraft biasanya hanya menggunakan satu atau dua warna saja. Hal ini dimaksudkan agar kesan klasiknya tidak hilang. Warna yang digunakan biasanya coklat tua atau hitam.

Gramasi kertas samson kraft yang umum digunakan adalah 150 gram dan 220 gram.

13. Kertas Hawai

desain undangan, jenis kertas undangan, kertas undangan hawai, kertas hawai, desain undangan unik, desain undangan keren, desain undangan hd
www.aliexpress.com

Jenis kertas yang satu ini memang sangat cocok digunakan untuk undangan. Memiliki tekstur kasar dan ketika diraba terasa lekukan-lekukan kecil beraturan. Kertas hawai mempunyai beragam warna.

Namun ada dua warna yang banyak diminati, yaitu warna merah maroon dan biru dongker. Kedua warna itu paling sering digunakan karena dianggap memiliki karakter. Hasil cetakan undangan dengan kertas hawai memiliki tampilan yang memukau dan berkualitas.

Agar mendapat hasil cetak undangan yang baik, maka immpresion pada mesin cetak ditambah supaya menghasilkan warna yang lebih solid.

14. Kertas Tulip

desain undangan, jenis kertas undangan, kertas undangan tulip, kertas tulip, desain undangan unik, desain undangan keren, desain undangan hd
www.tokopedia.com

Banyak yang menyebut kertas tulip sebagai kertas melon. Jenis kertas undangan ini memiliki tektur yang sangat unik dan artistik. Kertas tulip menimbulkan kertas mewah, unik, serta berkelas.

Kertas tulip tidak mempunyai gramatur, hanya ada dua pilihan ketebalan. Kertas yang tebal disebut dengan karton. Jenis kertas ini memiliki banyak pilihan warna, seperti kertas jasmine ada yang warna biru, putih, hijau, cream, pink, dan lain-lain.

15. Concorde

desain undangan, jenis kertas undangan, kertas undangan concorde, kertas concorde, desain undangan unik, desain undangan keren, desain undangan hd
id. pinterest.com

Concorde adalah jenis kertas undangan yang mempunyai karakteristik pada permukaanya penuh dengan serat garis yang tidak beraturan. Concorde memiliki dua jenis, yaitu:

  • Concorde tipisĀ dengan ketebalan 120 gram. Biasanya digunakan untuk kop surat atau amplop.
  • Concorde tebal dengan ketebalan 250 gram. Biasanya digunakan untuk kartu nama atau sertifikat.

Pada undangan, concorde ini digunakan untuk isi undangan pada umumnya hanya menggunakan satu warna cetak saja (hitam atau putih). Jadi akan menimbulkan kesan romantis.

Kekurangan dari jenis kertas ini adalah ketika dilipat kertas akan menyisakan luka pada teksturnya dan akan terlihat patah-patah.

16. Conqueror

desain undangan, jenis kertas undangan, kertas undangan conqueror, kertas conqueror, desain undangan unik, desain undangan keren, desain undangan hd
undanganpernikahantasikmalaya.wordpress.com

Kertas conqueror dan kertas concorde memiliki kemiripan dari segi teksturnya. Akan tetapi serat dari kertas concueror ini lebih halus dan seratnya lebih beraturan. Jenis kertas ini memilik dua jenis, yaitu laid brilliant dan woven brilliant. Masing-masing jenis tersebut memili ragam warna dan ketebalan.

Kertas conqueror termasuk jenis kertas imprort sehingga harganya terbilang mahal hingga saat ini. Inilah kertas yang sangat cocok digunakan untuk undangan agar terlihat eksklusif.

17. Linen / Bufallo

desain undangan, jenis kertas undangan, kertas undangan linen atau bufallo, kertas linen atau bufallo, desain undangan unik, desain undangan keren, desain undangan hd
jurnalmanajemen.com

Kertas linen atau bufallo memiliki tekstur permukaan yang tidak jauh beda dengan kertas concorde. Akan tetapi motif dan teksturnya terlihat bergaris dan pada seperti serat kain.

Jenis kertas undangan yang satu ini memiliki karakter yang kuat dan unik. Jika desain undangan yang dibuat sangat tepat, maka akan menghasilkan undangan yang terlihat mewah tetapi masih tetap elegan.

Selain untuk mencetak undangan, kertas linen atau bufallo juga sangat cocok digunakan untuk pembuatan sertifikat dan untuk mencetak foto. Varian gramasi yang dimiliki linen atau bufallo mulai 150 gram hingga 230 gram.

18. Akasia

desain undangan, jenis kertas undangan, kertas undangan akasia, kertas akasia, desain undangan unik, desain undangan keren, desain undangan hd
kreasiundangan.com

Karakteristik dari kertas akasia adalah tekstur permukaannya yang seperti kain dengan garis-garis membentuk tenunan. Biasanya jenis kertas ini digunakan untuk mencetak undangan, sertifikat, piagam dan foto.

Ketika mencetak hindari penggunaan warna blok, karena kertas akasia sering meninggalkan debu seperti pasir akibat potongan kertas. Hal ini lah yang akan berpengaruh pada hasil cetakan sebab warna yang dihasilkan menjadi bolong-bolong tidak valid.

Contoh Desain Undangan

www.pinterest.ch
desain undangan, jenis kertas undangan, desain undangan unik, desain undangan keren, desain undangan hd
www.freepik.com
desain undangan, jenis kertas undangan, desain undangan unik, desain undangan keren, desain undangan hd
www.freepik.com
desain undangan, jenis kertas undangan, desain undangan unik, desain undangan keren, desain undangan hd
gramho.com
desain undangan, jenis kertas undangan, desain undangan unik, desain undangan keren, desain undangan hd
www.freepik.com
desain undangan, jenis kertas undangan, desain undangan unik, desain undangan keren, desain undangan hd
www.sungrafika.com
desain undangan, jenis kertas undangan, desain undangan unik, desain undangan keren, desain undangan hd
www.freepik.com

Banyak sekali kan jenis kertas yang dapat digunakan untuk mencetak undangan. Semua bisa Anda pilih sesuai dengan keinginan dan budget yang ada. Ciptakan undangan se-spesial mungkin dengan desain undangan yang unik untuk acara paling istimewa Anda.

Dengan banyaknya jenis kertas, masing-masing memiliki kegunaan yang berbeda-beda. Jika akan membuat stiker, cari tau dulu tentang jenis kertas untuk stiker. Agar tidak sampai salah pilih dan dapat menyesuaikan dengan kebutuhan kita.

Referensi artikel: Harga dan Jenis Bahan Kertas Undangan Pernikahan

Tinggalkan komentar